PDB entry 1yuj

View 1yuj on RCSB PDB site
Description: solution nmr structure of the gaga factor/dna complex, 50 structures
Deposited on 1996-12-31, released 1997-12-31
The last revision prior to the SCOP 1.59 freeze date was dated 1997-12-31, with a file datestamp of 1997-12-31.
Experiment type: NMR50
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1yuja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yujA (A:)
    pkakrakhppgtekprsrsqseqpatcpicyavirqsrnlrrhlelrhfakpgv