PDB entry 1yui

View 1yui on RCSB PDB site
Description: solution nmr structure of the gaga factor/DNA complex, regularized mean structure
Class: DNA binding protein/DNA
Keywords: complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex
Deposited on 1996-12-31, released 1997-12-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gaga-factor
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yuia_
  • Chain 'B':
    Compound: DNA (5'-d(*gp*cp*cp*gp*ap*gp*ap*gp*tp*ap*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*gp*tp*ap*cp*tp*cp*tp*cp*gp*gp*c)-3')
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yuiA (A:)
    pkakrakhppgtekprsrsqseqpatcpicyavirqsrnlrrhlelrhfakpgv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.