PDB entry 1yub

View 1yub on RCSB PDB site
Description: solution structure of an rRNA methyltransferase (ermam) that confers macrolide-lincosamide-streptogramin antibiotic resistance, nmr, minimized average structure
Class: methyltransferase
Keywords: methyltransferase, erm, ermam, mls antibiotics, nmr, rRNA
Deposited on 1997-03-04, released 1998-03-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rRNA methyltransferase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: ERM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yuba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yubA (A:)
mnknikysqnfltsekvlnqiikqlnlketdtvyeigtgkghlttklakiskqvtsield
shlfnlsseklklntrvtlihqdilqfqfpnkqrykivgnipyhlstqiikkvvfesras
diyliveegfykrtldihrtlglllhtqvsiqqllklpaecfhpkpkvnsvlikltrhtt
dvpdkywklytyfvskwvnreyrqlftknqfhqamkhakvnnlstityeqvlsifnsyll
fngrk