Lineage for d1yuba_ (1yub A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129906Family c.66.1.24: rRNA adenine dimethylase-like [88784] (5 protein domains)
  6. 2129914Protein rRNA adenine dimethylase [53363] (2 species)
    contains additional all-alpha C-terminal domain (res.181-248)
  7. 2129922Species Streptococcus pneumoniae, Ermam [TaxId:1313] [53364] (1 PDB entry)
  8. 2129923Domain d1yuba_: 1yub A: [34219]

Details for d1yuba_

PDB Entry: 1yub (more details)

PDB Description: solution structure of an rrna methyltransferase (ermam) that confers macrolide-lincosamide-streptogramin antibiotic resistance, nmr, minimized average structure
PDB Compounds: (A:) rRNA methyltransferase

SCOPe Domain Sequences for d1yuba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]}
mnknikysqnfltsekvlnqiikqlnlketdtvyeigtgkghlttklakiskqvtsield
shlfnlsseklklntrvtlihqdilqfqfpnkqrykivgnipyhlstqiikkvvfesras
diyliveegfykrtldihrtlglllhtqvsiqqllklpaecfhpkpkvnsvlikltrhtt
dvpdkywklytyfvskwvnreyrqlftknqfhqamkhakvnnlstityeqvlsifnsyll
fngrk

SCOPe Domain Coordinates for d1yuba_:

Click to download the PDB-style file with coordinates for d1yuba_.
(The format of our PDB-style files is described here.)

Timeline for d1yuba_: