PDB entry 1yu5

View 1yu5 on RCSB PDB site
Description: Crystal Structure of the Headpiece Domain of Chicken Villin
Class: structural protein
Keywords: alpha helix,3-10 helix, STRUCTURAL PROTEIN
Deposited on 2005-02-11, released 2005-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.192
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: villin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yu5x_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yu5X (X:)
    ptkletfpldvlvntaaedlprgvdpsrkenhlsdedfkavfgmtrsafanlplwkqqnl
    kkekglf