PDB entry 1yu4

View 1yu4 on RCSB PDB site
Description: Major Tropism Determinant U1 Variant
Class: Viral protein
Keywords: C-type Lectin, Beta Sandwich, Beta Prism, variability, diversity-generating retroelement, Viral protein
Deposited on 2005-02-11, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.186
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major Tropism Determinant (Mtd-U1)
    Species: Bordetella phage BMP-1 [TaxId:263374]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q775D6
      • see remark 999 (343)
      • see remark 999 (345-346)
      • see remark 999 (356)
      • see remark 999 (358)
    Domains in SCOPe 2.07: d1yu4a1, d1yu4a2
  • Chain 'B':
    Compound: Major Tropism Determinant (Mtd-U1)
    Species: Bordetella phage BMP-1 [TaxId:263374]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q775D6
      • see remark 999 (343)
      • see remark 999 (345-346)
      • see remark 999 (356)
      • see remark 999 (358)
    Domains in SCOPe 2.07: d1yu4b1, d1yu4b2
  • Chain 'C':
    Compound: Major Tropism Determinant (Mtd-U1)
    Species: Bordetella phage BMP-1 [TaxId:263374]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q775D6
      • see remark 999 (343)
      • see remark 999 (345-346)
      • see remark 999 (356)
      • see remark 999 (358)
    Domains in SCOPe 2.07: d1yu4c1, d1yu4c2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yu4A (A:)
    mstavqfrggttaqhatftgaareitvdtdkntvvvhdgataggfplarhdlvktafika
    dksavaftrtgnatasikagtivevngklvqftadtaitmpaltagtdyaiyvcddgtvr
    adsnfsaptgytsttarkvggfhyapgsnaaaqaggnttaqineyslwdikfrpaaldpr
    gmtlvagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgsaaysdgawyn
    faevmthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsawniftskwgvv
    qasgclwtwgnefggvngaseytantggrgsvyaqpaaalfggnwnstsnsgsraanwns
    gpsnspanigargvcdhlile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yu4A (A:)
    vqfrggttaqhatftgaareitvdtdkntvvvhdgataggfplarhdlvktafikadksa
    vaftrtgnatasikagtivevngklvqftadtaitmpaltagtdyaiyvcddgtvradsn
    fsaptgytsttarkvggfhyapgsnaaaqaggnttaqineyslwdikfrpaaldprgmtl
    vagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgsaaysdgawynfaev
    mthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsawniftskwgvvqasg
    clwtwgnefggvngaseytantggrgsvyaqpaaalfggnwnstsnsgsraanwnsgpsn
    spanigargvcdhlil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yu4B (B:)
    mstavqfrggttaqhatftgaareitvdtdkntvvvhdgataggfplarhdlvktafika
    dksavaftrtgnatasikagtivevngklvqftadtaitmpaltagtdyaiyvcddgtvr
    adsnfsaptgytsttarkvggfhyapgsnaaaqaggnttaqineyslwdikfrpaaldpr
    gmtlvagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgsaaysdgawyn
    faevmthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsawniftskwgvv
    qasgclwtwgnefggvngaseytantggrgsvyaqpaaalfggnwnstsnsgsraanwns
    gpsnspanigargvcdhlile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yu4B (B:)
    vqfrggttaqhatftgaareitvdtdkntvvvhdgataggfplarhdlvktafikadksa
    vaftrtgnatasikagtivevngklvqftadtaitmpaltagtdyaiyvcddgtvradsn
    fsaptgytsttarkvggfhyapgsnaaaqaggnttaqineyslwdikfrpaaldprgmtl
    vagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgsaaysdgawynfaev
    mthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsawniftskwgvvqasg
    clwtwgnefggvngaseytantggrgsvyaqpaaalfggnwnstsnsgsraanwnsgpsn
    spanigargvcdhlil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yu4C (C:)
    mstavqfrggttaqhatftgaareitvdtdkntvvvhdgataggfplarhdlvktafika
    dksavaftrtgnatasikagtivevngklvqftadtaitmpaltagtdyaiyvcddgtvr
    adsnfsaptgytsttarkvggfhyapgsnaaaqaggnttaqineyslwdikfrpaaldpr
    gmtlvagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgsaaysdgawyn
    faevmthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsawniftskwgvv
    qasgclwtwgnefggvngaseytantggrgsvyaqpaaalfggnwnstsnsgsraanwns
    gpsnspanigargvcdhlile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yu4C (C:)
    vqfrggttaqhatftgaareitvdtdkntvvvhdgataggfplarhdlvktafikadksa
    vaftrtgnatasikagtivevngklvqftadtaitmpaltagtdyaiyvcddgtvradsn
    fsaptgytsttarkvggfhyapgsnaaaqaggnttaqineyslwdikfrpaaldprgmtl
    vagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgsaaysdgawynfaev
    mthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsawniftskwgvvqasg
    clwtwgnefggvngaseytantggrgsvyaqpaaalfggnwnstsnsgsraanwnsgpsn
    spanigargvcdhlil