![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.8: Mtd variable domain [143964] (1 protein) fold decorated with many additional structures; overall similarity to the Sulfatase modifying factor family; lacks the characteristic disulfide |
![]() | Protein Major tropism determinant (Mtd), C-terminal domain [143965] (1 species) |
![]() | Species Bordetella phage bpp-1 [TaxId:194699] [143966] (6 PDB entries) Uniprot Q775D6 171-380 includes related Bordetella phage proteins |
![]() | Domain d1yu4a2: 1yu4 A:171-380 [124034] Other proteins in same PDB: d1yu4a1, d1yu4b1, d1yu4c1 complexed with mg |
PDB Entry: 1yu4 (more details), 1.87 Å
SCOPe Domain Sequences for d1yu4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yu4a2 d.169.1.8 (A:171-380) Major tropism determinant (Mtd), C-terminal domain {Bordetella phage bpp-1 [TaxId: 194699]} kfrpaaldprgmtlvagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgs aaysdgawynfaevmthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsaw niftskwgvvqasgclwtwgnefggvngaseytantggrgsvyaqpaaalfggnwnstsn sgsraanwnsgpsnspanigargvcdhlil
Timeline for d1yu4a2:
![]() Domains from other chains: (mouse over for more information) d1yu4b1, d1yu4b2, d1yu4c1, d1yu4c2 |