PDB entry 1yt1

View 1yt1 on RCSB PDB site
Description: Crystal Structure of the Unliganded Form of GRP94, the ER Hsp90: Basis for Nucleotide-Induced Conformational Change, GRP94N(DELTA)41 APO CRYSTAL
Class: chaperone
Keywords: GRP94, gp96, Hsp90, Bergerat, Chaperone, Endoplasmic reticulum, HtpG
Deposited on 2005-02-09, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmin
    Species: Canis lupus [TaxId:9615]
    Gene: TRA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41148 (4-221)
      • cloning artifact (0-3)
    • Uniprot P41148 (226-235)
    Domains in SCOPe 2.07: d1yt1a2, d1yt1a3
  • Chain 'B':
    Compound: Endoplasmin
    Species: Canis lupus [TaxId:9615]
    Gene: TRA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41148 (4-221)
      • cloning artifact (0-3)
    • Uniprot P41148 (226-235)
    Domains in SCOPe 2.07: d1yt1b2, d1yt1b3
  • Heterogens: PG4, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yt1A (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yt1A (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtigtseflnkmteaqeqsts
    eligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitl
    vlkeeasdyleldtiknlvkkysqfinfpiyvwssktktvwdwelmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yt1B (B:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yt1B (B:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktktvwdwelmn