Lineage for d1yt1b2 (1yt1 B:69-337)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973216Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2973217Protein HSP90 [55876] (3 species)
  7. 2973259Species Dog (Canis familiaris) [TaxId:9615] [103225] (33 PDB entries)
    Uniprot P41148 76-285; Endoplasmin, GRP94
  8. 2973285Domain d1yt1b2: 1yt1 B:69-337 [123990]
    Other proteins in same PDB: d1yt1a3, d1yt1b3
    automated match to d1u2oa_
    complexed with 1pe, pg4

Details for d1yt1b2

PDB Entry: 1yt1 (more details), 2.2 Å

PDB Description: crystal structure of the unliganded form of grp94, the er hsp90: basis for nucleotide-induced conformational change, grp94n(delta)41 apo crystal
PDB Compounds: (B:) Endoplasmin

SCOPe Domain Sequences for d1yt1b2:

Sequence, based on SEQRES records: (download)

>d1yt1b2 d.122.1.1 (B:69-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
lreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalag
neeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqst
seligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttit
lvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn

Sequence, based on observed residues (ATOM records): (download)

>d1yt1b2 d.122.1.1 (B:69-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
lreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalag
neeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqst
seligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttit
lvlkeeasdyleldtiknlvkkysqfinfpiyvwssktktvwdwelmn

SCOPe Domain Coordinates for d1yt1b2:

Click to download the PDB-style file with coordinates for d1yt1b2.
(The format of our PDB-style files is described here.)

Timeline for d1yt1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yt1b3