PDB entry 1yqk

View 1yqk on RCSB PDB site
Description: Human 8-oxoguanine glycosylase crosslinked with guanine containing DNA
Class: hydrolase/DNA
Keywords: Disulfide crosslink, DNA glycosylase, undamaged DNA, HYDROLASE-DNA COMPLEX
Deposited on 2005-02-01, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.235
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-glycosylase/DNA lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: OGG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15527 (3-End)
      • cloning artifact (0-2)
      • engineered (140)
    Domains in SCOPe 2.07: d1yqka1, d1yqka2, d1yqka3
  • Chain 'B':
    Compound: 5'-d(*gp*gp*tp*ap*gp*ap*cp*cp*tp*gp*g)-3'
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 5'-d(p*cp*ap*gp*gp*tp*cp*tp*ap*c)-3'
    Species: synthetic, synthetic
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yqkA (A:)
    sefghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
    gvrllrqdpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfpslqala
    gpeveahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgt
    kvadciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwg
    pyagwaqavlfsadlrqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yqkA (A:)
    sefghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
    llrqdpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfpslqalagpe
    veahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkva
    dciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpya
    gwaqavlfsadl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.