PDB entry 1ymn

View 1ymn on RCSB PDB site
Description: The study of reductive unfolding pathways of RNase A (Y92L mutant)
Class: hydrolase
Keywords: hydrolase
Deposited on 2005-01-21, released 2006-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.193
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease pancreatic
  Species: Bos taurus [TaxId:9913]
  Gene: RNASE1, RNS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
    • engineered (91)
  Domains in SCOPe 2.08: d1ymna_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ymnA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgssklpncaykttqankhiivacegnpyvpvhf
  dasv