Lineage for d1ymna_ (1ymn A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [54079] (210 PDB entries)
  8. Domain d1ymna_: 1ymn A: [162253]
    automated match to d1a2wa_
    mutant

Details for d1ymna_

PDB Entry: 1ymn (more details), 1.45 Å

PDB Description: The study of reductive unfolding pathways of RNase A (Y92L mutant)
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d1ymna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymna_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgssklpncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d1ymna_ are not available.

Timeline for d1ymna_: