PDB entry 1yl2

View 1yl2 on RCSB PDB site
Description: Conkunitzin-S1 is the first member of a new Kunitz-type neurotoxin family- Structural and functional characterization
Class: toxin
Keywords: neurotoxin; Kunitz-domain; potassium channel blocker
Deposited on 2005-01-19, released 2005-04-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-07-15, with a file datestamp of 2008-07-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conkunitzin-s1
    Species: Conus striatus [TaxId:6493]
    Domains in SCOPe 2.06: d1yl2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yl2A (A:)
    kdrpslcdlpadsgsgtkaekriyynsarkqclrfdytgqggnennfrrtydcqrtclyt