PDB entry 1yju

View 1yju on RCSB PDB site
Description: Solution structure of the apo form of the sixth soluble domain of Menkes protein
Class: hydrolase
Keywords: metallochaperone, protein-protein interaction, copper(I), metal homeostasis, Structural Proteomics in Europe, SPINE, Structural Genomics, hydrolase
Deposited on 2005-01-15, released 2006-01-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Copper-transporting ATPase 1
  Species: Homo sapiens [TaxId:9606]
  Gene: ATP7A
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q04656 (1-72)
    • cloning artifact (0)
    • cloning artifact (73-74)
  Domains in SCOPe 2.05: d1yjua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yjuA (A:)
  mgdgvlelvvrgmtcascvhkiessltkhrgilycsvalatnkahikydpeiigprdiih
  tieslgfeaslvkie