SCOPe 2.05: Domain d1yjua_: 1yju A:

Lineage for d1yjua_ (1yju A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.0: automated matches [191590] (1 protein)
   not a true family

6. Protein automated matches [191063] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254969] (10 PDB entries)

8. Domain d1yjua_: 1yju A: [241040]
   automated match to d1s6ua_

Details for d1yjua_

PDB Entry: 1yju

PDB Description: solution structure of the apo form of the sixth soluble domain of menkes protein

PDB Compounds: (A:) Copper-transporting ATPase 1

SCOPe Domain Sequences for d1yjua_:

Sequence; same for both SEQRES and ATOM records:

>d1yjua_ d.58.17.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgdgvlelvvrgmtcascvhkiessltkhrgilycsvalatnkahikydpeiigprdiih
tieslgfeaslvkie

Timeline for d1yjua_:

• d1yjua_ first appeared in SCOPe 2.04
  
• d1yjua_ is called d1yjua1 in SCOPe 2.06
  
• d1yjua_ appears in the current release, SCOPe 2.08, called d1yjua1