PDB entry 1yji

View 1yji on RCSB PDB site
Description: RDC-refined Solution NMR structure of reduced putidaredoxin
Class: electron transport
Keywords: ferredoxin, [2Fe-2S], redox, iron-sulfur, electron transfer, NMR, cytochrome P450cam, ELECTRON TRANSPORT
Deposited on 2005-01-14, released 2005-06-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1yjia1
  • Heterogens: FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yjiA (A:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw