PDB entry 1yib

View 1yib on RCSB PDB site
Description: Crystal Structure of the Human EB1 C-terminal Dimerization Domain
Class: structural protein
Keywords: coiled coil; four helix bundle, STRUCTURAL PROTEIN
Deposited on 2005-01-11, released 2005-03-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.221
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1yiba1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yibA (A:)
    gplgsgvgngddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvl
    qrivdilyatdegfvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yibA (A:)
    ddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyat
    d