PDB entry 1ygh

View 1ygh on RCSB PDB site
Description: hat domain of gcn5 from saccharomyces cerevisiae
Class: gene regulation
Keywords: transcriptional regulation, histone acetylation, n-acetyltransferase, gcn5 related n-acetyltransferase family, gene regulation
Deposited on 1999-05-27, released 1999-08-02
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (transcriptional activator gcn5)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GCN5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ygha_
  • Chain 'B':
    Compound: protein (transcriptional activator gcn5)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GCN5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1yghb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yghA (A:)
    kiefrvvnndntkenmmvltglknifqkqlpkmpkeyiarlvydrshlsmavirkpltvv
    ggityrpfdkrefaeivfcaissteqvrgygahlmnhlkdyvrntsnikyfltyadnyai
    gyfkkqgftkeitldksiwmgyikdyeggtlmqcsmlpriryld
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yghB (B:)
    kiefrvvnndntkenmmvltglknifqkqlpkmpkeyiarlvydrshlsmavirkpltvv
    ggityrpfdkrefaeivfcaissteqvrgygahlmnhlkdyvrntsnikyfltyadnyai
    gyfkkqgftkeitldksiwmgyikdyeggtlmqcsmlpriryld