PDB entry 1ydy

View 1ydy on RCSB PDB site
Description: Crystal structure of periplasmic glycerophosphodiester phosphodiesterase from Escherichia coli
Class: hydrolase
Keywords: phosphodiesterase, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE
Deposited on 2004-12-27, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycerophosphoryl diester phosphodiesterase
    Species: Escherichia coli [TaxId:562]
    Gene: glpQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ydya_
  • Chain 'B':
    Compound: Glycerophosphoryl diester phosphodiesterase
    Species: Escherichia coli [TaxId:562]
    Gene: glpQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ydyb_
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ydyA (A:)
    mkltlknlsmaimmstivmgssamaadsnekiviahrgasgylpehtlpakamayaqgad
    yleqdlvmtkddnlvvlhdhyldrvtdvadrfpdrarkdgryyaidftldeikslkfteg
    fdiengkkvqtypgrfpmgksdfrvhtfeeeiefvqglnhstgknigiypeikapwfhhq
    egkdiaaktlevlkkygytgkddkvylqcfdadelkriknelepkmgmelnlvqliaytd
    wnetqqkqpdgswvnynydwmfkpgamkqvaeyadgigpdyhmlieetsqpgnikltgmv
    qdaqqnklvvhpytvrsdklpeytpdvnqlydalynkagvnglftdfpdkavkfln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydyA (A:)
    nekiviahrgasgylpehtlpakamayaqgadyleqdlvmtkddnlvvlhdhyldrvtdv
    adrfpdrarkdgryyaidftldeikslkftegfdiengkkvqtypgrfpmgksdfrvhtf
    eeeiefvqglnhstgknigiypeikapwfhhqegkdiaaktlevlkkygytgkddkvylq
    cfdadelkriknelepkmgmelnlvqliaytdwnetqqkqpdgswvnynydwmfkpgamk
    qvaeyadgigpdyhmlieetsqpgnikltgmvqdaqqnklvvhpytvrsdklpeytpdvn
    qlydalynkagvnglftdfpdkavkfln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ydyB (B:)
    mkltlknlsmaimmstivmgssamaadsnekiviahrgasgylpehtlpakamayaqgad
    yleqdlvmtkddnlvvlhdhyldrvtdvadrfpdrarkdgryyaidftldeikslkfteg
    fdiengkkvqtypgrfpmgksdfrvhtfeeeiefvqglnhstgknigiypeikapwfhhq
    egkdiaaktlevlkkygytgkddkvylqcfdadelkriknelepkmgmelnlvqliaytd
    wnetqqkqpdgswvnynydwmfkpgamkqvaeyadgigpdyhmlieetsqpgnikltgmv
    qdaqqnklvvhpytvrsdklpeytpdvnqlydalynkagvnglftdfpdkavkfln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydyB (B:)
    nekiviahrgasgylpehtlpakamayaqgadyleqdlvmtkddnlvvlhdhyldrvtdv
    adrfpdrarkdgryyaidftldeikslkftegfdiengkkvqtypgrfpmgksdfrvhtf
    eeeiefvqglnhstgknigiypeikapwfhhqegkdiaaktlevlkkygytgkddkvylq
    cfdadelkriknelepkmgmelnlvqliaytdwnetqqkqpdgswvnynydwmfkpgamk
    qvaeyadgigpdyhmlieetsqpgnikltgmvqdaqqnklvvhpytvrsdklpeytpdvn
    qlydalynkagvnglftdfpdkavkfln