PDB entry 1ydl

View 1ydl on RCSB PDB site
Description: Crystal Structure of the Human TFIIH, Northeast Structural Genomics Target HR2045.
Class: transcription
Keywords: alpha-beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, TRANSCRIPTION
Deposited on 2004-12-24, released 2005-02-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.236
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: general transcription factor IIH, polypeptide 5
    Species: Homo sapiens [TaxId:9606]
    Gene: C6orf175
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6ZYL4 (Start-78)
      • see remark 999 (8-12)
      • engineered (15)
      • modified residue (23)
      • modified residue (68)
    Domains in SCOPe 2.04: d1ydla1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ydlA (A:)
    mghhhhhhshgtrkgmliecdpamkqfllyldesnalgkkfiiqdiddthvfviaelvnv
    lqervgelmdqnafsltqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydlA (A:)
    shgtrkgmliecdpamkqfllyldesnalgkkfiiqdiddthvfviaelvnvlqervgel
    mdqnafsltqk