PDB entry 1yca

View 1yca on RCSB PDB site
Description: distal pocket polarity in ligand binding to myoglobin: deoxy and carbonmonoxy forms of a threonine68 (e11) mutant investigated by x-ray crystallography and infrared spectroscopy
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1993-08-10, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.189
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02189 (0-152)
      • conflict (67)
    Domains in SCOPe 2.07: d1ycaa_
  • Chain 'B':
    Compound: Myoglobin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02189 (0-152)
      • conflict (67)
    Domains in SCOPe 2.07: d1ycab_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ycaA (A:)
    glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
    lkkhgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
    gdfgadaqgamskalelfrndmaakykelgfqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ycaB (B:)
    glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
    lkkhgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
    gdfgadaqgamskalelfrndmaakykelgfqg