PDB entry 1yb2

View 1yb2 on RCSB PDB site
Description: Structure of a putative methyltransferase from Thermoplasma acidophilum.
Class: structural genomics, unknown function
Keywords: structural genomics, methyltransferase, Thermoplasma acidophilum, Midwest Center for Structural Genomics, MCSG, Protein Structure Initiative, PSI, UNKNOWN FUNCTION
Deposited on 2004-12-18, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.201
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Ta0852
    Species: THERMOPLASMA ACIDOPHILUM [TaxId:273075]
    Gene: Ta0852
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HJW1 (Start-274)
      • modified residue (50)
      • modified residue (80)
      • modified residue (111)
      • modified residue (123)
      • modified residue (151)
      • modified residue (178)
      • modified residue (199-200)
      • modified residue (228)
      • modified residue (237)
      • modified residue (270)
    Domains in SCOPe 2.07: d1yb2a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yb2A (A:)
    mgsshhhhhhssglvprgshmkrsspvilvsedeygkfdestnsilvkgkmhhlgisrvi
    epgdelivsgksfivsdfspmyfgrvirrntqiiseidasyiimrcglrpgmdilevgvg
    sgnmssyilyalngkgtltvverdednlkkamdnlsefydignvrtsrsdiadfisdqmy
    daviadipdpwnhvqkiasmmkpgsvatfylpnfdqsektvlslsasgmhhletvelmkr
    rilvregatrpasddlthtafitfaikksgmvyri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yb2A (A:)
    pvilvsedeygkfdestnsilvgkmhhlgsrviepgdelivsgksfivsdfspmyfgrvi
    cglrpgmdilevgvgsgnmssyilyalngkgtltvverdednlkkamdnlsefydignvr
    tsrsdiadfisdqmydaviadipdpwnhvqkiasmmkpgsvatfylpnfdqsektvlsls
    asgmhhletvelmkrrilvregatrpasddlthtafitfaikksgmvyri