Lineage for d1yb2a1 (1yb2 A:6-255)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893201Family c.66.1.13: tRNA(1-methyladenosine) methyltransferase-like [64117] (5 proteins)
    contains additional N-terminal beta-sandwich domain
  6. 2893205Protein Hypothetical protein Ta0852 [142585] (1 species)
    forms dimer similar to half-tetramer of the other members but with swapped N-terminal domains; variant topology of the N-terminal domain
  7. 2893206Species Thermoplasma acidophilum [TaxId:2303] [142586] (1 PDB entry)
    Uniprot Q9HJW1 6-255
  8. 2893207Domain d1yb2a1: 1yb2 A:6-255 [122868]

Details for d1yb2a1

PDB Entry: 1yb2 (more details), 2.01 Å

PDB Description: Structure of a putative methyltransferase from Thermoplasma acidophilum.
PDB Compounds: (A:) hypothetical protein Ta0852

SCOPe Domain Sequences for d1yb2a1:

Sequence, based on SEQRES records: (download)

>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]}
pvilvsedeygkfdestnsilvkgkmhhlgisrviepgdelivsgksfivsdfspmyfgr
virrntqiiseidasyiimrcglrpgmdilevgvgsgnmssyilyalngkgtltvverde
dnlkkamdnlsefydignvrtsrsdiadfisdqmydaviadipdpwnhvqkiasmmkpgs
vatfylpnfdqsektvlslsasgmhhletvelmkrrilvregatrpasddlthtafitfa
ikksgmvyri

Sequence, based on observed residues (ATOM records): (download)

>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]}
pvilvsedeygkfdestnsilvgkmhhlgsrviepgdelivsgksfivsdfspmyfgrvi
cglrpgmdilevgvgsgnmssyilyalngkgtltvverdednlkkamdnlsefydignvr
tsrsdiadfisdqmydaviadipdpwnhvqkiasmmkpgsvatfylpnfdqsektvlsls
asgmhhletvelmkrrilvregatrpasddlthtafitfaikksgmvyri

SCOPe Domain Coordinates for d1yb2a1:

Click to download the PDB-style file with coordinates for d1yb2a1.
(The format of our PDB-style files is described here.)

Timeline for d1yb2a1: