PDB entry 1yaf

View 1yaf on RCSB PDB site
Description: Structure of TenA from Bacillus subtilis
Class: transcription
Keywords: TRANSCRIPTION, Thiaminase
Deposited on 2004-12-17, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.231
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional activator tenA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: tenA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yafa_
  • Chain 'B':
    Compound: Transcriptional activator tenA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: tenA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yafb_
  • Chain 'C':
    Compound: Transcriptional activator tenA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: tenA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yafc_
  • Chain 'D':
    Compound: Transcriptional activator tenA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: tenA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yafd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yafA (A:)
    mgshhhhhhditslykkagsenlyfqgmkfseecrsaaaewwegsfvhpfvqgigdgtlp
    idrfkyyvlqdsyylthfakvqsfgaayakdlyttgrmashaqgtyeaemalhrefaell
    eiseeerkafkpsptaysytshmyrsvlsgnfaeilaallpcywlyyevgekllhcdpgh
    piyqkwigtyggdwfrqqveeqinrfdelaensteevrakmkenfvissyyeyqfwgmay
    rkegwsdsaikeveecgasrhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yafA (A:)
    kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
    akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
    sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
    laensteevrakmkenfvissyyeyqfwgmayrkegwsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yafB (B:)
    mgshhhhhhditslykkagsenlyfqgmkfseecrsaaaewwegsfvhpfvqgigdgtlp
    idrfkyyvlqdsyylthfakvqsfgaayakdlyttgrmashaqgtyeaemalhrefaell
    eiseeerkafkpsptaysytshmyrsvlsgnfaeilaallpcywlyyevgekllhcdpgh
    piyqkwigtyggdwfrqqveeqinrfdelaensteevrakmkenfvissyyeyqfwgmay
    rkegwsdsaikeveecgasrhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yafB (B:)
    kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
    akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
    sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
    laensteevrakmkenfvissyyeyqfwgmayrkegwsd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yafC (C:)
    mgshhhhhhditslykkagsenlyfqgmkfseecrsaaaewwegsfvhpfvqgigdgtlp
    idrfkyyvlqdsyylthfakvqsfgaayakdlyttgrmashaqgtyeaemalhrefaell
    eiseeerkafkpsptaysytshmyrsvlsgnfaeilaallpcywlyyevgekllhcdpgh
    piyqkwigtyggdwfrqqveeqinrfdelaensteevrakmkenfvissyyeyqfwgmay
    rkegwsdsaikeveecgasrhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yafC (C:)
    kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
    akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
    sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
    laensteevrakmkenfvissyyeyqfwgmayrkegws
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yafD (D:)
    mgshhhhhhditslykkagsenlyfqgmkfseecrsaaaewwegsfvhpfvqgigdgtlp
    idrfkyyvlqdsyylthfakvqsfgaayakdlyttgrmashaqgtyeaemalhrefaell
    eiseeerkafkpsptaysytshmyrsvlsgnfaeilaallpcywlyyevgekllhcdpgh
    piyqkwigtyggdwfrqqveeqinrfdelaensteevrakmkenfvissyyeyqfwgmay
    rkegwsdsaikeveecgasrhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yafD (D:)
    kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
    akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
    sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
    laensteevrakmkenfvissyyeyqfwgmayrkegws