Lineage for d1yafa_ (1yaf A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732777Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 2732816Protein Transcriptional activator TenA [110030] (1 species)
  7. 2732817Species Bacillus subtilis [TaxId:1423] [110031] (5 PDB entries)
    Uniprot P25052
  8. 2732822Domain d1yafa_: 1yaf A: [122814]
    automated match to d1to9a_

Details for d1yafa_

PDB Entry: 1yaf (more details), 2.6 Å

PDB Description: Structure of TenA from Bacillus subtilis
PDB Compounds: (A:) Transcriptional activator tenA

SCOPe Domain Sequences for d1yafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yafa_ a.132.1.3 (A:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
laensteevrakmkenfvissyyeyqfwgmayrkegwsd

SCOPe Domain Coordinates for d1yafa_:

Click to download the PDB-style file with coordinates for d1yafa_.
(The format of our PDB-style files is described here.)

Timeline for d1yafa_: