PDB entry 1y8a

View 1y8a on RCSB PDB site
Description: Structure of gene product AF1437 from Archaeoglobus fulgidus
Class: structural genomics, unknown function
Keywords: Archaeoglobus fulgidus, structural genomics, protein structure initiative, PSI, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2004-12-10, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.185
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein AF1437
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: AF1437
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28835 (22-329)
      • cloning artifact (19-21)
      • cloning artifact (262)
      • cloning artifact (330-331)
    Domains in SCOPe 2.07: d1y8aa1, d1y8aa2, d1y8aa3
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y8aA (A:)
    mgsshhhhhhssgrenlyfqghmfftdwegpwiltdfalelcmavfnnarffsnlseydd
    ylayevrregyeagytlklltpflaaagvknrdveriaelsakfvpdaekamatlqerwt
    pvvistsytqylrrtasmigvrgelhgtevdfdsiavpeglreellsiidviaslsgeel
    frkldelfsrsevrkivesvkavgagekakimrgyceskgidfpvvvgdsisdykmfeaa
    rglggvaiafngneyalkhadvviisptamseakvielfmerkerafevlsavsipetei
    yimensdfgevlekskrmrvrlrglagelggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y8aA (A:)
    qghmfftdwegpwiltdfalelcmavfnnarffsnlseyddylayevrregyeagytlkl
    ltpflaaagvknrdveriaelsakfvpdaekamatlqerwtpvvistsytqylrrtasmi
    gvrgelhgtevdfdsiavpeglreellsiidviaslsgeelfrkldelfsrsevrkives
    vkavgagekakimrgyceskgidfpvvvgdsisdykmfeaarglggvaiafngneyalkh
    advviisptamseakvielfmerkerafevlsavsipeteiyimensdfgevlekskrmr
    vrlrglagelggs