SCOPe 2.08: Domain d1y8aa1: 1y8a A:1-308

Lineage for d1y8aa1 (1y8a A:1-308)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.24: AF1437-like [159537] (1 protein)
   the insertion subdomain is a rudiment 4-helical bundle; extra alpha-hairpin insertion after strand 3

6. Protein Hypothetical protein AF1437 [159538] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [159539] (1 PDB entry)
   Uniprot O28835 1-308

8. Domain d1y8aa1: 1y8a A:1-308 [145913]
   Other proteins in same PDB: d1y8aa2, d1y8aa3
   complexed with mg

Details for d1y8aa1

PDB Entry: 1y8a, 1.4 Å

PDB Description: Structure of gene product AF1437 from Archaeoglobus fulgidus

PDB Compounds: (A:) hypothetical protein AF1437

SCOPe Domain Sequences for d1y8aa1:

Sequence; same for both SEQRES and ATOM records:

>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeoglobus fulgidus [TaxId: 2234]}
mfftdwegpwiltdfalelcmavfnnarffsnlseyddylayevrregyeagytlklltp
flaaagvknrdveriaelsakfvpdaekamatlqerwtpvvistsytqylrrtasmigvr
gelhgtevdfdsiavpeglreellsiidviaslsgeelfrkldelfsrsevrkivesvka
vgagekakimrgyceskgidfpvvvgdsisdykmfeaarglggvaiafngneyalkhadv
viisptamseakvielfmerkerafevlsavsipeteiyimensdfgevlekskrmrvrl
rglagelg

Timeline for d1y8aa1:

• d1y8aa1 first appeared in SCOP 1.75
  
• d1y8aa1 appears in SCOPe 2.07