PDB entry 1y7q

View 1y7q on RCSB PDB site
Description: Mammalian SCAN domain dimer is a domain-swapped homologue of the HIV capsid C-terminal domain
Class: transcription
Keywords: SCAN domain; retroviral capsid C-terminal domain; dimer; C2H2 zinc finger associated
Deposited on 2004-12-09, released 2005-01-18
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-18, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 174
    Species: HOMO SAPIENS
    Gene: ZNF174, ZSCAN8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15697 (2-97)
      • cloning artifact (0-1)
      • engineered (65)
      • engineered (76)
    Domains in SCOP 1.73: d1y7qa1
  • Chain 'B':
    Compound: Zinc finger protein 174
    Species: HOMO SAPIENS
    Gene: ZNF174, ZSCAN8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15697 (2-97)
      • cloning artifact (0-1)
      • engineered (65)
      • engineered (76)
    Domains in SCOP 1.73: d1y7qb1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y7qA (A:)
    gskncpdpelcrqsfrrfcyqevsgpqealsqlrqlcrqwlqpelhtkeqilellvmeqf
    ltilpeeiqarvrhrclmsskeivtlvedfhraskkpk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y7qB (B:)
    gskncpdpelcrqsfrrfcyqevsgpqealsqlrqlcrqwlqpelhtkeqilellvmeqf
    ltilpeeiqarvrhrclmsskeivtlvedfhraskkpk