Lineage for d1y7qa1 (1y7q A:37-132)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639734Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 639818Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (2 families) (S)
  5. 639840Family a.28.3.2: SCAN domain [140466] (2 proteins)
    Pfam PF02023; forms segment-swapped dimers compared to the retroviral capsid domain
  6. 639841Protein Zinc finger protein 174 [140469] (1 species)
  7. 639842Species Human (Homo sapiens) [TaxId:9606] [140470] (1 PDB entry)
  8. 639843Domain d1y7qa1: 1y7q A:37-132 [122714]
    mutant

Details for d1y7qa1

PDB Entry: 1y7q (more details)

PDB Description: mammalian scan domain dimer is a domain-swapped homologue of the hiv capsid c-terminal domain
PDB Compounds: (A:) Zinc finger protein 174

SCOP Domain Sequences for d1y7qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7qa1 a.28.3.2 (A:37-132) Zinc finger protein 174 {Human (Homo sapiens) [TaxId: 9606]}
kncpdpelcrqsfrrfcyqevsgpqealsqlrqlcrqwlqpelhtkeqilellvmeqflt
ilpeeiqarvrhrclmsskeivtlvedfhraskkpk

SCOP Domain Coordinates for d1y7qa1:

Click to download the PDB-style file with coordinates for d1y7qa1.
(The format of our PDB-style files is described here.)

Timeline for d1y7qa1: