PDB entry 1y6p

View 1y6p on RCSB PDB site
Description: Crystal structure of disulfide engineered porcine pancratic phospholipase a2 to group-x isozyme
Class: hydrolase
Keywords: Hydrolase, Disulfide engineered PLA2, Porcine pancratic isozyme
Deposited on 2004-12-06, released 2005-03-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.188
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2, major isoenzyme
  Species: Sus scrofa [TaxId:9823]
  Gene: PLA2G1B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00592 (0-123)
    • engineered (7)
    • engineered (19)
    • engineered (49)
    • see remark 999 (124-130)
  Domains in SCOPe 2.04: d1y6pa_
• Chain 'B':
  Compound: phospholipase a2, major isoenzyme
  Species: Sus scrofa [TaxId:9823]
  Gene: PLA2G1B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00592 (0-123)
    • engineered (7)
    • engineered (19)
    • engineered (49)
    • see remark 999 (124-130)
  Domains in SCOPe 2.04: d1y6pb_
• Heterogens: CA, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y6pA (A:)
  alwqfrslikcaipgshplldfnnygcycglggsgtpvdeldrccethdccyrdaknlds
  ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
  kkyckgesdkc
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y6pB (B:)
  alwqfrslikcaipgshplldfnnygcycglggsgtpvdeldrccethdccyrdaknlds
  ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
  kkyckgesdkc