PDB entry 1y2u

View 1y2u on RCSB PDB site
Description: Crystal structure of the common edible mushroom (Agaricus bisporus) lectin in complex with Lacto-N-biose
Class: sugar binding protein
Keywords: ABL, Agaricus bisporus, lectin, mushroom, lacto-N-biose, SUGAR BINDING PROTEIN
Deposited on 2004-11-23, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lectin
  Species: Agaricus bisporus [TaxId:5341]
  Database cross-references and differences (RAF-indexed):
  • GB AAA85813 (0-131)
    • see remark 999 (62)
    • see remark 999 (132-141)
  Domains in SCOPe 2.07: d1y2ua_
• Chain 'B':
  Compound: lectin
  Species: Agaricus bisporus [TaxId:5341]
  Database cross-references and differences (RAF-indexed):
  • GB AAA85813 (0-131)
    • see remark 999 (62)
    • see remark 999 (132-141)
  Domains in SCOPe 2.07: d1y2ub_
• Heterogens: NAG, GAL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y2uA (A:)
  tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
  desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
  rrfaieytvtegdnlkanliig
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y2uB (B:)
  tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
  desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
  rrfaieytvtegdnlkanliig