PDB entry 1y2s

View 1y2s on RCSB PDB site
Description: Ovine Prion Protein Variant R168
Class: unknown function
Keywords: Prion Protein, Sheep, ovPrP, Polymorphism, Scrapie, TSE, Glycoprotein, GPI-anchor, UNKNOWN FUNCTION
Deposited on 2004-11-23, released 2004-12-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Ovis aries [TaxId:9940]
    Gene: PRNP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23907 (2-112)
      • cloning artifact (0-1)
    Domains in SCOPe 2.02: d1y2sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y2sA (A:)
    gsvvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdrysnqnnfvhd
    cvnitvkqhtvttttkgenftetdikimervveqmcitqyqresqayyqrgas