PDB entry 1y16

View 1y16 on RCSB PDB site
Description: mouse prion protein with mutations S170N and N174T
Class: unknown function
Keywords: prion protein, PrP, PrnP, TSE, CWD, UNKNOWN FUNCTION
Deposited on 2004-11-17, released 2005-01-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major prion protein
  Species: Mus musculus [TaxId:10090]
  Gene: PRNP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04925 (0-111)
    • engineered (49)
    • engineered (53)
  Domains in SCOPe 2.04: d1y16a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y16A (A:)
  vvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqynnqntfvhdcv
  nitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss