PDB entry 1y15

View 1y15 on RCSB PDB site
Description: Mouse Prion Protein with mutation N174T
Class: unknown function
Keywords: PrP, NMR, prion protein, TSE, CWD, UNKNOWN FUNCTION
Deposited on 2004-11-17, released 2004-12-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Mus musculus [TaxId:10090]
    Gene: PRNP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04925 (0-111)
      • engineered (53)
    Domains in SCOPe 2.02: d1y15a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y15A (A:)
    vvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqntfvhdcv
    nitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss