PDB entry 1xyw

View 1xyw on RCSB PDB site
Description: elk prion protein
Class: unknown function
Keywords: NMR, PrP, CWD, prion protein, TSE
Deposited on 2004-11-11, released 2004-12-28
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major prion protein
  Species: Cervus elaphus nelsoni
  Gene: PRNP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P67986 (0-110)
  Domains in SCOP 1.73: d1xywa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xywA (A:)
  vvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqynnqntfvhdcv
  nitvkqhtvttttkgenftetdikmmervveqmcitqyqreseayyqrgas