Lineage for d1xywa_ (1xyw A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716046Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 716047Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 716048Family d.6.1.1: Prion-like [54099] (2 proteins)
  6. 716049Protein Prion protein domain [54100] (12 species)
  7. 716052Species American elk (Cervus elaphus nelsoni) [TaxId:9864] [117765] (1 PDB entry)
  8. 716053Domain d1xywa_: 1xyw A: [116234]

Details for d1xywa_

PDB Entry: 1xyw (more details)

PDB Description: elk prion protein
PDB Compounds: (A:) major prion protein

SCOP Domain Sequences for d1xywa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xywa_ d.6.1.1 (A:) Prion protein domain {American elk (Cervus elaphus nelsoni) [TaxId: 9864]}
vvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqynnqntfvhdcv
nitvkqhtvttttkgenftetdikmmervveqmcitqyqreseayyqrgas

SCOP Domain Coordinates for d1xywa_:

Click to download the PDB-style file with coordinates for d1xywa_.
(The format of our PDB-style files is described here.)

Timeline for d1xywa_: