PDB entry 1xyo

View 1xyo on RCSB PDB site
Description: structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei
Class: hydrolase
Keywords: xylanase, hydrolase
Deposited on 1994-08-09, released 1995-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.19
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase II
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xyoa1, d1xyoa2
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase II
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xyob1, d1xyob2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xyoA (A:)
    etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
    nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
    qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
    ssgsasitvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xyoB (B:)
    etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
    nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
    qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
    ssgsasitvs