![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
![]() | Protein Xylanase II [49979] (21 species) Partial overlap with common fold and the active sites of the other endoglucanases |
![]() | Species Trichoderma reesei, xynII [TaxId:51453] [49985] (16 PDB entries) |
![]() | Domain d1xyoa1: 1xyo A:2-190 [24323] Other proteins in same PDB: d1xyoa2, d1xyob2 |
PDB Entry: 1xyo (more details), 1.5 Å
SCOPe Domain Sequences for d1xyoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xyoa1 b.29.1.11 (A:2-190) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]} tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs sgsasitvs
Timeline for d1xyoa1: