PDB entry 1xwv

View 1xwv on RCSB PDB site
Description: Structure of the house dust mite allergen Der f 2: Implications for function and molecular basis of IgE cross-reactivity
Class: allergen
Keywords: beta sheets, allergen
Deposited on 2004-11-02, released 2004-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.221
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Der f II
    Species: Dermatophagoides farinae [TaxId:6954]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xwva_
  • Chain 'B':
    Compound: Der f II
    Species: Dermatophagoides farinae [TaxId:6954]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xwvb_
  • Heterogens: PE3, XPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xwvA (A:)
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfmkcplvkgqqydakytwnvpkiapksenvvvtvklvgdngvlaca
iathakird

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xwvB (B:)
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfmkcplvkgqqydakytwnvpkiapksenvvvtvklvgdngvlaca
iathakird