SCOPe 2.08: Domain d1xwvb_: 1xwv B:

Lineage for d1xwvb_ (1xwv B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.7: ML domain [81287] (3 proteins)
   implicated in lipid recognition, particularly in the recognition of pathogen related products
   automatically mapped to Pfam PF02221

6. Protein Major mite allergen [49256] (2 species)
   contains additional N-terminal strand

7. Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (5 PDB entries)
   Uniprot Q00855 18-146

8. Domain d1xwvb_: 1xwv B: [116135]
   complexed with pe3, xpe

Details for d1xwvb_

PDB Entry: 1xwv, 1.83 Å

PDB Description: Structure of the house dust mite allergen Der f 2: Implications for function and molecular basis of IgE cross-reactivity

PDB Compounds: (B:) Der f II

SCOPe Domain Sequences for d1xwvb_:

Sequence; same for both SEQRES and ATOM records:

>d1xwvb_ b.1.18.7 (B:) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId: 6954]}
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfmkcplvkgqqydakytwnvpkiapksenvvvtvklvgdngvlaca
iathakird

Timeline for d1xwvb_:

• d1xwvb_ first appeared in SCOP 1.71
  
• d1xwvb_ appears in SCOPe 2.07