PDB entry 1xu6

View 1xu6 on RCSB PDB site
Description: Structure of the C-terminal domain from Trypanosoma brucei Variant Surface Glycoprotein MITat1.2
Class: immune system, membrane protein
Keywords: cysteine knot, IMMUNE SYSTEM, MEMBRANE PROTEIN
Deposited on 2004-10-25, released 2004-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: variant surface glycoprotein mitat 1.2
  Species: Trypanosoma [TaxId:5702]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26332 (5-79)
    • cloning artifact (0-4)
  Domains in SCOPe 2.08: d1xu6a1, d1xu6a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xu6A (A:)
  gshmlevltqkhkpaesqqqaaetegscnkkdqneckspckwhndaenkkctldkeeakk
  vadetakdgktgntnttgss