SCOPe 2.08: Domain d1xu6a1: 1xu6 A:359-433

Lineage for d1xu6a1 (1xu6 A:359-433)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
   disulfide-rich fold; common core is alpha+beta with two conserved disulfides

4. Superfamily g.16.3: Variant surface glycoprotein MITAT 1.2, VSG 221, C-terminal domain [118251] (1 family)
   alpha-beta(2)-alpha; fragment of a larger dimeric protein

5. Family g.16.3.1: Variant surface glycoprotein MITAT 1.2, VSG 221, C-terminal domain [118252] (1 protein)

6. Protein Variant surface glycoprotein MITAT 1.2, VSG 221, C-terminal domain [118253] (1 species)

7. Species Trypanosoma brucei brucei [TaxId:5702] [118254] (1 PDB entry)
   Uniprot P26332 385-459 # structure of the N-terminal domain (27-390) is also known (58090)

8. Domain d1xu6a1: 1xu6 A:359-433 [116047]
   Other proteins in same PDB: d1xu6a2

Details for d1xu6a1

PDB Entry: 1xu6

PDB Description: Structure of the C-terminal domain from Trypanosoma brucei Variant Surface Glycoprotein MITat1.2

PDB Compounds: (A:) variant surface glycoprotein mitat 1.2

SCOPe Domain Sequences for d1xu6a1:

Sequence; same for both SEQRES and ATOM records:

>d1xu6a1 g.16.3.1 (A:359-433) Variant surface glycoprotein MITAT 1.2, VSG 221, C-terminal domain {Trypanosoma brucei brucei [TaxId: 5702]}
evltqkhkpaesqqqaaetegscnkkdqneckspckwhndaenkkctldkeeakkvadet
akdgktgntnttgss

Timeline for d1xu6a1:

• d1xu6a1 first appeared in SCOP 1.71, called d1xu6a_
  
• d1xu6a1 appears in SCOPe 2.07