PDB entry 1xts

View 1xts on RCSB PDB site
Description: Structure of small GTPase human Rheb in complex with GTP
Class: signaling protein
Keywords: beta saddle, P-loop, SIGNALING PROTEIN
Deposited on 2004-10-24, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein Rheb
    Species: Homo sapiens [TaxId:9606]
    Gene: Rheb
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15382 (Start-168)
      • expression tag (169-171)
    Domains in SCOPe 2.07: d1xtsa2, d1xtsa3
  • Heterogens: MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1xtsA (A:)
mpqsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvd
tagqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnk
kdlhmervisyeegkalaeswnaaflessakenqtavdvfrriileaeklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1xtsA (A:)
pqsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdt
agqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkk
dlhmervisyeegkalaeswnaaflessakenqtavdvfrriileaekleh