PDB entry 1xsx
View 1xsx on RCSB PDB site
Description: NMR Structure of Sso10a, a Hyperthermophile DNA-binding Protein with an Extended Anti-parallel Coiled Coil
Class: DNA binding protein
Keywords: winged helix-turn-helix, anti-parallel coiled coil dimer, hyperthermophile DNA-binding protein, DNA BINDING PROTEIN
Deposited on
2004-10-20, released
2005-03-01
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Sso10a
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: Sso10a
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1xsxa_ - Chain 'B':
Compound: Sso10a
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: Sso10a
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1xsxb_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1xsxA (A:)
akkkskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymlt
kkgeelledirkfnemrknmdqlkekinsvlsirq
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1xsxB (B:)
akkkskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymlt
kkgeelledirkfnemrknmdqlkekinsvlsirq