Lineage for d1xsxb_ (1xsx B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694214Family a.4.5.49: Archaeal DNA-binding protein [109677] (1 protein)
    contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers
  6. 2694215Protein Sso10a (SSO10449) [109678] (1 species)
  7. 2694216Species Sulfolobus solfataricus [TaxId:2287] [109679] (2 PDB entries)
    Uniprot Q5W1E8
  8. 2694219Domain d1xsxb_: 1xsx B: [122290]
    automated match to d1r7ja_

Details for d1xsxb_

PDB Entry: 1xsx (more details)

PDB Description: nmr structure of sso10a, a hyperthermophile dna-binding protein with an extended anti-parallel coiled coil
PDB Compounds: (B:) Sso10a

SCOPe Domain Sequences for d1xsxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsxb_ a.4.5.49 (B:) Sso10a (SSO10449) {Sulfolobus solfataricus [TaxId: 2287]}
akkkskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymlt
kkgeelledirkfnemrknmdqlkekinsvlsirq

SCOPe Domain Coordinates for d1xsxb_:

Click to download the PDB-style file with coordinates for d1xsxb_.
(The format of our PDB-style files is described here.)

Timeline for d1xsxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xsxa_