PDB entry 1xri

View 1xri on RCSB PDB site
Description: X-ray structure of a putative phosphoprotein phosphatase from Arabidopsis thaliana gene AT1G05000
Class: structural genomics, unknown function
Keywords: Structural Genomics, Protein Structure Initiative, PSI, CESG, Center for Eukaryotic Structural Genomics, AT1G05000, phosphoprotein phosphatase, UNKNOWN FUNCTION
Deposited on 2004-10-14, released 2004-10-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.204
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: At1g05000
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g05000
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xria_
  • Chain 'B':
    Compound: At1g05000
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g05000
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xrib_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xriA (A:)
    hlipplnfsmvdngifrsgfpdsanfsflqtlglrsiiylcpepypesnlqflksngirl
    fqfgiegnkepfvnipdhkirmalkvlldeknhpvlihckrgkhrtgclvgclrklqkwc
    ltsifdeyqrfaaakarvsdqrfmeifdvss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xriB (B:)
    hlipplnfsmvdngifrsgfpdsanfsflqtlglrsiiylcpepypesnlqflksngirl
    fqfgiegnkepfvnipdhkirmalkvlldeknhpvlihckrgkhrtgclvgclrklqkwc
    ltsifdeyqrfaaakarvsdqrfmeifdvss