PDB entry 1xpn

View 1xpn on RCSB PDB site
Description: NMR structure of P. aeruginosa protein PA1324: Northeast Structural Genomics Consortium target PaP1
Class: structural genomics, unknown function
Keywords: b-barrel, structural genomics, Northeast Structural Genomics Consortium, NESG, Protein Structure Initiative, PSI, UNKNOWN FUNCTION
Deposited on 2004-10-08, released 2004-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA1324
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA1324
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I420 (20-169)
      • expression tag (0-19)
      • conflict (42)
    Domains in SCOPe 2.06: d1xpna1, d1xpna2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xpnA (A:)
gsshhhhhhssglvprgshmasnpndlpdfpeheyaatqqvgggvingdlyltsasgaiq
kgtntkvalepatsymkayyakfgnldaakrdpdvqppvldprratyvreattdqngrfd
fdhipngtyyisseltwsaqsdgktiteggtvtklvtvsgsqpqkvlltr