PDB entry 1xph

View 1xph on RCSB PDB site
Description: Structure of DC-SIGNR and a portion of repeat domain 8
Class: immune system, sugar binding protein
Keywords: C-type lectin, carbohydrate recognition domain, repeat domain, IMMUNE SYSTEM, SUGAR BINDING PROTEIN
Deposited on 2004-10-08, released 2005-04-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: 0.177
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD209 antigen-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1xpha1
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xphA (A:)
    iyqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvvikta
    eeqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedca
    efsgsgwndnrcdvdnywickkpaacfrde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xphA (A:)
    aferlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqt
    srsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndn
    rcdvdnywickkpaacfrd