Lineage for d1xpha1 (1xph A:265-394)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1048063Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1048064Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1048065Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1048101Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species)
  7. 1048102Species Human (Homo sapiens) [TaxId:9606] [69858] (4 PDB entries)
    Uniprot Q9NNX6 219-397
  8. 1048103Domain d1xpha1: 1xph A:265-394 [122211]
    automatically matched to d1k9ja_
    complexed with ca

Details for d1xpha1

PDB Entry: 1xph (more details), 1.41 Å

PDB Description: Structure of DC-SIGNR and a portion of repeat domain 8
PDB Compounds: (A:) CD209 antigen-like protein 1

SCOPe Domain Sequences for d1xpha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpha1 d.169.1.1 (A:265-394) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]}
crhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnr
fswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvd
nywickkpaa

SCOPe Domain Coordinates for d1xpha1:

Click to download the PDB-style file with coordinates for d1xpha1.
(The format of our PDB-style files is described here.)

Timeline for d1xpha1: