Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69858] (4 PDB entries) Uniprot Q9NNX6 219-397 |
Domain d1xpha1: 1xph A:265-394 [122211] automatically matched to d1k9ja_ complexed with ca |
PDB Entry: 1xph (more details), 1.41 Å
SCOPe Domain Sequences for d1xpha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xpha1 d.169.1.1 (A:265-394) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]} crhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnr fswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvd nywickkpaa
Timeline for d1xpha1: