PDB entry 1xox

View 1xox on RCSB PDB site
Description: solution structure of human survivin
Class: apoptosis
Keywords: Bir Domain; Apoptosis
Deposited on 2004-10-07, released 2005-01-18
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-18, with a file datestamp of 2007-07-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apoptosis inhibitor survivin
    Species: HOMO SAPIENS
    Gene: BIRC5, API4, IAP4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xoxa1
  • Chain 'B':
    Compound: apoptosis inhibitor survivin
    Species: HOMO SAPIENS
    Gene: BIRC5, API4, IAP4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xoxb1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xoxA (A:)
    mgaptlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffc
    fkelegwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaket
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xoxB (B:)
    mgaptlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffc
    fkelegwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaket